SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031156 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031156
Domain Number 1 Region: 75-257
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-74
Family F-box associated region, FBA 0.00000167
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily F-box domain 2.62e-17
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031156   Gene: ENSMMUG00000023668   Transcript: ENSMMUT00000033292
Sequence length 293
Comment pep:known chromosome:MMUL_1:1:14765006:14771378:1 gene:ENSMMUG00000023668 transcript:ENSMMUT00000033292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPHPKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITEDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLTSADYFVLASFEPPPVTIQQWNNAAWTEVSYTFSDYPRGVRYILFQHGGSDTQ
YWAGWYGPRVTNSSIVVSHKRTRNQASSEAQPGKKHGQEEAAQSPYQAVLQIF
Download sequence
Identical sequences A0A2K5LHC3 A0A2K5VFT6 A0A2K5ZVH6 F7GZS6
XP_002802223.1.72884 XP_002802224.1.72884 XP_005544850.1.63531 XP_005544851.1.63531 XP_005544852.1.63531 XP_005544853.1.63531 XP_011851982.1.47321 XP_011851983.1.47321 XP_011904754.1.92194 XP_011904755.1.92194 XP_011904756.1.92194 XP_014967284.1.72884 XP_014967400.1.72884 9544.ENSMMUP00000040605 ENSMMUP00000031156 ENSMMUP00000040605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]