SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031243 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031243
Domain Number 1 Region: 285-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-60
Family SPRY domain 0.00000917
Further Details:      
 
Domain Number 2 Region: 10-86
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 89-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031243   Gene: ENSMMUG00000023720   Transcript: ENSMMUT00000033383
Sequence length 465
Comment pep:known chromosome:MMUL_1:4:25957444:25978297:1 gene:ENSMMUG00000023720 transcript:ENSMMUT00000033383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKRLRQETFCCP
QCRAPFHMHSLRPNKQLGSLIEALKEMDQEMSCEEHGEQLHLFCEDEGKLICWRCERAPQ
HKGHTTALVEDVCQGYKEKLQKAVTKLRQLEDRCTEQRLSTAIRITKWKEKVQIQRQKIQ
SDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEVGLGLKSNELKSHIQELEEKCQGS
AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSELYFDVKKMLSSHRVNVTLDPDT
AHHELILSEDRRQVTRGYTQENQNISSRRFTAFPCVLGSEGFTSGRRYFEVDVGEGTGWD
LGVCMENVQRGTGMKQEPQSGFWTLRLCRKKGYVALTSPPTSLHLHEHPLLVGVFLDYEA
GVVSFYNGTTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPLPDD
Download sequence
Identical sequences F7HAV2
XP_014991208.1.72884 XP_014991209.1.72884 XP_014991210.1.72884 ENSMMUP00000031243 ENSMMUP00000031243 9544.ENSMMUP00000031243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]