SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031314 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031314
Domain Number 1 Region: 159-410,540-647
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-73
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0012
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily UBA-like 5.89e-27
Family UBA domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031314
Domain Number - Region: 896-927
Classification Level Classification E-value
Superfamily TPR-like 0.0806
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031314   Gene: ENSMMUG00000023773   Transcript: ENSMMUT00000033458
Sequence length 1077
Comment pep:known chromosome:MMUL_1:14:112274519:112327760:-1 gene:ENSMMUG00000023773 transcript:ENSMMUT00000033458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAELQQDDAAGAADGHSSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG
RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLSYNLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCPV
SDQTSKESTSTESSSLDVESTFSSPEDSLHKSKPLTSSRSSMEMPAQPAPRTVTDEEINF
VKTCLQRWRSEIEQDIQDLKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGH
YWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAA
PNESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDFSTS
QEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVMLSPAMQGVIL
AIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKR
VVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSV
YLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKA
ASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAE
NLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK
Download sequence
Identical sequences A0A2K5VZ96 F7GVG0
XP_001085291.1.72884 XP_005579741.1.63531 ENSMMUP00000031314 9544.ENSMMUP00000031315 ENSMMUP00000031315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]