SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031332 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031332
Domain Number 1 Region: 318-611
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-70
Family Kelch motif 0.0000632
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 1.31e-25
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031332   Gene: ENSMMUG00000023789   Transcript: ENSMMUT00000033477
Sequence length 634
Comment pep:known chromosome:MMUL_1:4:53273012:53276680:-1 gene:ENSMMUG00000023789 transcript:ENSMMUT00000033477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKIAKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLL
EGLSKMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSTQRVDLNDISPLG
LATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYVVNIAE
TYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTIGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQKRTHFSLSVFNGL
LYAAGGRNAEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVADGRVLVTGGYIANAYS
RSVCAYDPASDSWQELPSLSTPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSP
ATGQWSYAAPLQVGVSTAGVSALHGRAYLVGGWNEGEKKYKKCIQCFSPELNEWTEDDEL
PEATVGVSCCTLSMPNNVTRESRASSVSSVPVSI
Download sequence
Identical sequences A0A2K5X4U3 F7HT97
ENSMMUP00000031332 ENSMMUP00000031332 XP_001109056.1.72884 XP_005552777.1.63531 XP_005552778.1.63531 XP_005552779.1.63531 XP_005552780.1.63531 XP_014992048.1.72884 XP_014992049.1.72884 XP_014992050.1.72884 XP_015304794.1.63531 9544.ENSMMUP00000031332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]