SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031372 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031372
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.73e-116
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000000228
Further Details:      
 
Domain Number 2 Region: 261-379
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.44e-46
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031372   Gene: ENSMMUG00000028670   Transcript: ENSMMUT00000038255
Sequence length 380
Comment pep:known chromosome:MMUL_1:MT:14741:15881:1 gene:ENSMMUG00000028670 transcript:ENSMMUT00000038255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPMRKSNPILKMINRSFIDLPAPPNLSMWWNFGSLLAACLILQIITGLLLAMHYSPDTS
SAFSSIAHITRDVKYGWITRYLHANGASMLFICLFLHIGRGLYYGSYLLLETWNIGIMLL
LMTMTTAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVQWIWGGYAIDSPTLTRFFT
LHFILPFIIIALTTVHLLFLHETGSNNPCGISSDSDKIAFHPYYTTKDILGLVLLLFILA
TLTLLSPNLLNDPDNYIPADPLNTPPHIKPEWYFLFAYTILRSIPNKLGGVLALFLSILI
LAAIPMLHKSKQQSMMFRPLSQFLFWLLITILLTLTWIGSEPVVQPLTTIGQVASMMYFI
TILILMPLASLIENNLLKWT
Download sequence
Identical sequences A0A088CFM7 Q6IYG6
9544.ENSMMUP00000031372 ENSMMUP00000031372 YP_026116.1.72884 ENSMMUP00000031372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]