SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031611 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031611
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-40
Family Galectin (animal S-lectin) 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031611   Gene: ENSMMUG00000009527   Transcript: ENSMMUT00000038511
Sequence length 139
Comment pep:known chromosome:MMUL_1:19:46038188:46043581:-1 gene:ENSMMUG00000009527 transcript:ENSMMUT00000038511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLSVPHTESVSLSTGSTVTIKGRPLVCFFNEPHLQVDFHTEMKEDSDIAFHFQVYFGN
RVVMNSREFKIWKEEVESKNMPFQDGQEFELSILVLEDKYQVMVNGQAYYNFNHRIPVSS
VKMVQVWRDISLTKFNVSN
Download sequence
Identical sequences ENSMMUP00000031611 ENSMMUP00000031611 XP_001087874.2.72884 XP_005589262.1.63531 9544.ENSMMUP00000031611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]