SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031620 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031620
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-44
Family F-box associated region, FBA 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031620   Gene: ENSMMUG00000028764   Transcript: ENSMMUT00000038519
Sequence length 124
Comment pep:known chromosome:MMUL_1:19:45280502:45284739:-1 gene:ENSMMUG00000028764 transcript:ENSMMUT00000038519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WCSKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKEVVKF
SASPDPVLQWTERGCRQVSHVFTNFGKGIRYVSFEQYGRDVSSWVGHYGALVTHSSVRVR
IRLS
Download sequence
Identical sequences G7NNJ8 G7PXI3
9544.ENSMMUP00000031620 ENSMMUP00000031620 ENSMMUP00000031620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]