SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031758 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031758
Domain Number 1 Region: 175-417
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.56e-46
Family Epoxide hydrolase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031758   Gene: ENSMMUG00000009656   Transcript: ENSMMUT00000013479
Sequence length 440
Comment pep:known chromosome:MMUL_1:19:16847479:16858963:-1 gene:ENSMMUG00000009656 transcript:ENSMMUT00000013479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTGVTDGIFCCLLGTPPNAVGPLESVESSDGYTFVEVKPGRVLRVKHAGPAPAAAAPPP
LSASSDAAQGDLSGLVRCQRRITVYRNGRLLVENLGRAPRADLLHGQNGSGEPPAALEVE
LADPAGSDGRSAPGSGSGSGSGSGSGGRRRRARRPKRTIHIDCEKRITSCKGAQADVVLF
FIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFK
RYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSIFNMPTCVLH
CLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELT
VPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLLHEFLLWE
PEPSPKALPEPLPAPPEDKK
Download sequence
Identical sequences A0A0A0MVD9 I2CYV7
ENSPANP00000006069 9544.ENSMMUP00000031758 ENSMMUP00000031758 NP_001252713.1.72884 XP_005588430.1.63531 ENSMMUP00000031758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]