SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031786 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031786
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily t-snare proteins 2.43e-33
Family t-snare proteins 0.00000927
Further Details:      
 
Domain Number 2 Region: 151-219
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.75e-16
Family SNARE fusion complex 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031786   Gene: ENSMMUG00000011427   Transcript: ENSMMUT00000038706
Sequence length 249
Comment pep:known chromosome:MMUL_1:19:12818875:12825083:-1 gene:ENSMMUG00000011427 transcript:ENSMMUT00000038706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWD
LEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNR
EILAGKPAPQKSLSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHM
SGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLL
LVLILLFSL
Download sequence
Identical sequences A0A2K5WXH7 A0A2K6D866 F6YXV7
ENSMMUP00000031786 ENSMMUP00000031786 NP_001248622.1.72884 XP_005588249.2.63531 XP_011709427.1.29376 9544.ENSMMUP00000031786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]