SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031930 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031930
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000000000012
Family Thyroglobulin type-1 domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031930   Gene: ENSMMUG00000028913   Transcript: ENSMMUT00000038849
Sequence length 98
Comment pep:known chromosome:MMUL_1:8:135449544:135450271:1 gene:ENSMMUG00000028913 transcript:ENSMMUT00000038849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAEGQAIPGTRSAMGKPKKCPTPCQLQAEQAFLRTVQALLPNSSMLPTLSNTYIPQCSAD
GQWRQVQCDGPPEQVFEWYQRWEAQNKGQELMPAELLV
Download sequence
Identical sequences ENSMMUP00000031930 9544.ENSMMUP00000031930 ENSMMUP00000031930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]