SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031933 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031933
Domain Number 1 Region: 58-245
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-25
Family Clp protease, ClpP subunit 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031933   Gene: ENSMMUG00000028914   Transcript: ENSMMUT00000038852
Sequence length 277
Comment pep:known chromosome:MMUL_1:19:6261139:6272088:1 gene:ENSMMUG00000028914 transcript:ENSMMUT00000038852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAILVGGARVAACRYPALGPRLAAHFPAQRPPQRTPQNGLALQRSLHATAARALPLIP
IVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYIN
SPGEQAGAFLGARGACQGARVTQGTRIPGQGCSLSGKGCRASEFQKWLETAKRCLLLAFE
PRFTSRFYVSNIIIIIDNFMKTNKMNVNVYLGETEALQNEESAMERDRYMSPMEAQEFGI
LDKVLVHPPQDGEDEPTLVQKEPVEATPAAEPVPAST
Download sequence
Identical sequences ENSMMUP00000031933 9544.ENSMMUP00000031933 ENSMMUP00000031933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]