SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032087 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032087
Domain Number 1 Region: 240-316
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.19e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032087   Gene: ENSMMUG00000028979   Transcript: ENSMMUT00000039003
Sequence length 380
Comment pep:known chromosome:MMUL_1:8:67174222:67175364:1 gene:ENSMMUG00000028979 transcript:ENSMMUT00000039003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGMHLGAAAAGEDDLFLHKSLSASTAKRLEAAFRSTPPGMDLSLAPPPRERPASSSSS
PLGCFEPADPEGAGLLLPPPGGGGGGGGAGSGGGGGVGVPGLLVGTAGVGSDPSLSSLPA
GAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAA
EGCSNAHLHGGARVPPGGLGGGGGGGGGSSSGSGGGGGAGSGGGGGSSSSSSSKKSKEQK
ALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALE
EMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPE
KCALFNSVSSSLCKQCTEKP
Download sequence
Identical sequences ENSMMUP00000032087 ENSMMUP00000032087 9544.ENSMMUP00000032087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]