SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032139 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032139
Domain Number 1 Region: 211-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.01e-63
Family Reprolysin-like 0.00012
Further Details:      
 
Domain Number 2 Region: 423-499
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.22e-19
Family Blood coagulation inhibitor (disintegrin) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032139   Gene: ENSMMUG00000006033   Transcript: ENSMMUT00000039056
Sequence length 821
Comment pep:known chromosome:MMUL_1:8:39496329:39590098:1 gene:ENSMMUG00000006033 transcript:ENSMMUT00000039056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGVGSPSGTLRVRWLLLLCLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPR
PYSKQVSYLIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTVITDHPNIQNHCHFRGYV
EGVYNSSVALSNCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVHKEPLKCGVSNK
DIEKETTKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
LLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIAGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSEC
DVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCF
IEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGADKICRNFQCVDASVLNYDCDIQKKCHGHGVCNSNK
NCHCENGWAPPNCETKGYGGSVDSGPTYNGNEMNTALRDGLLVFFFLIVPLIVCAIFIFI
KRDQLWRRYFRKKRSQTYESDGKNQANPSRQPVSVPRHVSPVTPPREVPIYANRFPVPTY
AAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT
Download sequence
Identical sequences 9544.ENSMMUP00000007922 ENSMMUP00000032139 ENSMMUP00000007922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]