SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032165 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032165
Domain Number 1 Region: 322-566
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9e-33
Family Exostosin 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032165   Gene: ENSMMUG00000017700   Transcript: ENSMMUT00000024877
Sequence length 579
Comment pep:known chromosome:MMUL_1:8:28871682:28905665:1 gene:ENSMMUG00000017700 transcript:ENSMMUT00000024877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTC
KNQPKPSLPTEWALCGEREDRLELLKLSTFALIITPGDPRLVISSGCATRLFEALEVGAV
PVVLGEQVQLPYQDMLQWNEAALVVPKPRVTEVHFLLRSLSDSDLLAMRRQGRFLWETYF
STADSIFNTVLAMIRTRIQIPAAPIREEAAAEIPHRSGKAAGTDPNMADNGDLDLGPVET
EPPYASPRYLRNFTLTVTDFYRSWNSAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIG
GGAGGSGKEFQAALGGNVPREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPK
LPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRV
WREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQA
IRDMVDEYINCEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCPQALSHDDSHFHERHKCI
NFFVKVYGYMPLLYTQFRVDSVLFKTRLPHDKTKCFKFI
Download sequence
Identical sequences 9544.ENSMMUP00000032165 ENSMMUP00000032165 ENSMMUP00000032165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]