SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032346 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032346
Domain Number 1 Region: 77-154,189-414
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.91e-34
Family Spore coat polysaccharide biosynthesis protein SpsA 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032346   Gene: ENSMMUG00000010922   Transcript: ENSMMUT00000039260
Sequence length 553
Comment pep:known chromosome:MMUL_1:20:67484258:67494138:1 gene:ENSMMUG00000010922 transcript:ENSMMUT00000039260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGQALKLPSRRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM
VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLREGMDRVRDVVRT
STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG
VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS
YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG
LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG
KKPEQYSLAFAEV
Download sequence
Identical sequences F7GLN9 G7Q1H5
ENSMMUP00000014325 NP_001104247.1.72884 XP_005592427.1.63531 XP_014981903.1.72884 XP_014981904.1.72884 XP_015298584.1.63531 XP_015298585.1.63531 9544.ENSMMUP00000014325 ENSMMUP00000032346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]