SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032494 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000032494
Domain Number - Region: 5-61
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000657
Family SPRY domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032494   Gene: ENSMMUG00000029168   Transcript: ENSMMUT00000039411
Sequence length 61
Comment pep:known scaffold:MMUL_1:1099214054525:838:2133:-1 gene:ENSMMUG00000029168 transcript:ENSMMUT00000039411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITGLVDRLNRFRVEIAFTWEVTNHNIRLFGDVRRLMFRRGSLNSDRSDYFAAWGTWVFSS
G
Download sequence
Identical sequences ENSMMUP00000032494 9544.ENSMMUP00000032494 ENSMMUP00000032494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]