SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032543 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032543
Domain Number 1 Region: 37-340
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.55e-104
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000428
Further Details:      
 
Domain Number 2 Region: 329-496
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 0.00000000000667
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032543   Gene: ENSMMUG00000020525   Transcript: ENSMMUT00000039455
Sequence length 533
Comment pep:known chromosome:MMUL_1:20:22024124:22057066:-1 gene:ENSMMUG00000020525 transcript:ENSMMUT00000039455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLRRLLQRGRPLAASGRRVGRREARLGTGPGVAVRVRFAPSPTGFLHLGGLRTALYN
YIFAKKYQGSFILRLEDTDQTRFVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQR
LELYAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQMPRYDNRCRNMSQEQVAQKLA
KDPKPAIRFRLEQAAPAFEDLVYGWNRHDVASVEGDPVIMKSDGFPTYHLACVVDDHHMG
ISHVLRGSEWLVSTAKHLLLYQALGWHPPHFAHLPLLLNRDGSKLSKRQGDIFLEHFAAE
GFLPDSLLDIITNCGSGFAENQMGRTLPELITQFNLTRVTCHSALLDLEKLPEFNRLHLQ
RLVNNESQRCQLVEKLQALVEEAFGSQLQNRDVLNPIYMERILLLRQGHICRLQDLVSPV
YSYLWTRPSVGRAQLDAISEEVDVIAKRVLGLLERSGMSLTQDMLSGELKKLSEGLEGTK
HSNVMKLLRVALSGQQVRQGHRLDCSLEPLIDPLNLFLAGTELNVQGTRMKEI
Download sequence
Identical sequences ENSMMUP00000032543 9544.ENSMMUP00000032541 ENSMMUP00000032541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]