SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032685 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032685
Domain Number 1 Region: 604-687
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.57e-36
Family Kix domain of CBP (creb binding protein) 0.00000371
Further Details:      
 
Domain Number 2 Region: 1087-1212
Classification Level Classification E-value
Superfamily Bromodomain 1.01e-35
Family Bromodomain 0.000000486
Further Details:      
 
Domain Number 3 Region: 2074-2130
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.75e-26
Family Nuclear receptor coactivator interlocking domain 0.0000499
Further Details:      
 
Domain Number 4 Region: 1779-1863
Classification Level Classification E-value
Superfamily TAZ domain 6.54e-24
Family TAZ domain 0.00000184
Further Details:      
 
Domain Number 5 Region: 397-458
Classification Level Classification E-value
Superfamily TAZ domain 0.000000000000017
Family TAZ domain 0.0000231
Further Details:      
 
Domain Number 6 Region: 1715-1762
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000412
Family ZZ domain 0.0000902
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000032685
Domain Number - Region: 1293-1334
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00403
Family PHD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032685   Gene: ENSMMUG00000002286   Transcript: ENSMMUT00000039619
Sequence length 2457
Comment pep:known chromosome:MMUL_1:20:3858895:3868651:-1 gene:ENSMMUG00000002286 transcript:ENSMMUT00000039619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPGLRPPSPSAPARPLARARCSPSQPAGPPTPVRAFAGPAVRSRGCFREQVKMAENLLD
GPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKH
KQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGKSPLSQGD
SSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPG
LLNSNSGHSLMNQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLAETLTQVS
PQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSL
PTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQGIATGPTADPEKRKLIQQQLVLLLHAHKC
QRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQAILGSPASGIQNTIGSVGTGQQ
NATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLG
NNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSS
TGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESAN
SRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGTQPPVIPQAQPVRPPN
GPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAIS
PSRMPQPPNMMGAHSNNMMAQAPAQSQFLPQNQFPPSSGAMSVGMGQPPAQTGVSQGQVP
GAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAA
TQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSS
QQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKVETQTED
TEPDPGESKGEPRSEMMEEDLQGASQVKEETDTAEQKSEPMEVDEKKPEVKVEVKEEEES
STNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDY
FDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVF
EQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQ
GENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSG
FVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASS
DKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPN
TRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFW
PNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANK
KKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRD
AFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLN
IKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQP
PAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIERE
AQQQQHLYRVNINNGMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAP
LPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQ
VLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAM
QAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQ
QQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMA
AQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQP
QASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHP
GLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
Download sequence
Identical sequences 9544.ENSMMUP00000032686 ENSMMUP00000032685 ENSMMUP00000032686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]