SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032728 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032728
Domain Number 1 Region: 277-306
Classification Level Classification E-value
Superfamily TrpR-like 0.0000445
Family SPO1678-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032728   Gene: ENSMMUG00000012383   Transcript: ENSMMUT00000017365
Sequence length 702
Comment pep:known chromosome:MMUL_1:7:137463761:137474019:1 gene:ENSMMUG00000012383 transcript:ENSMMUT00000017365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRNQLVQRVLQELQEAVECEGLEGLVGAALEAKQVLSSFTLPTCREGGPGLQVLEVDS
VALSLYPDDAPRNMLPLVCKGEGSLLFEAASMLLWGDAGLSLELRARTVVEMLLHRHYYL
QGMIDSKVMLQAVRYSLCSEESPEMTSLPPATLEAIFDADVKASCFPSSFSNVWHLYALA
SVLRRNIYSIYPMRNLKIRPYFNRVIRPRRCDHMPSTLHIMWAGQPLTSHFFRHQYFAPV
VGLEEVEAEGAPGMAPALPTLAPLSSPAKTLELLNREPGLSYSHLCERYSVTKSTFYRWR
RQSQEHRQRVAARFSAKHFLQDSFHRGGVVPLQQFLQRFPEISRSTYYAWKHELLGSGTC
PALPPKEVLGMEELEKLPEEQVAEEELECSALAVSSPGMVLMQRAKLYLEHCISLNTLVP
YRCFKRRFPGISRSTYYNWRRKALRRNPSFKPAPALSAPGTPQPASVGEGAVIPWKSEAE
EGAGKATDEEPPTPQELLPLRMPLSRWQRRLRRAARRQVLSGHLPFCRFRLRYPSLSPSA
FWVWKSLARGWPRGLSKLQVPAPTLGKGGQEAEEKQEEEAGRDVTTVMAPPVRASSEDAE
GGPSREGALQEGATAQGQPHSGPLLSQPVVAAAGGRDGRMLVMDMIATTKFKAQAKLFLQ
KRFQSKSFPSYKEFSALFPLTARSTYYMWKRALYDGLTLVDG
Download sequence
Identical sequences A0A2K6AM83 F7APM8 G7PAU5
ENSMMUP00000032728 ENSMMUP00000032728 9544.ENSMMUP00000032728 NP_001181827.1.72884 XP_011763888.1.29376 XP_011763889.1.29376 XP_011763890.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]