SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032741 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032741
Domain Number 1 Region: 3-46,95-197
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.34e-18
Family Acetyl xylan esterase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032741   Gene: ENSMMUG00000029276   Transcript: ENSMMUT00000039677
Sequence length 207
Comment pep:known chromosome:MMUL_1:7:136715521:136718876:1 gene:ENSMMUG00000029276 transcript:ENSMMUT00000039677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQHPEVKGPSIGLLGFSKGGDLCLSMASFLKGITATVLINACVANTITPLHYKDMIIPK
LVDDLGKVKITKSGFLTFMDTWSNPLEERNHQSLIPLEKAQGPFLFIVGMDDQNWKSEFY
AQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAVFYGGEPKAHSKA
QVDAWQQIQTFFHKHLNGKKCVKHSKI
Download sequence
Identical sequences A0A2K6API3 F7AN72 G8F568
NP_001165423.1.72884 9544.ENSMMUP00000032741 ENSMMUP00000032741 ENSMMUP00000032741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]