SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032742 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032742
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3e-28
Family Atu1826-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032742   Gene: ENSMMUG00000029277   Transcript: ENSMMUT00000039678
Sequence length 169
Comment pep:known scaffold:MMUL_1:1099214804262:73:678:1 gene:ENSMMUG00000029277 transcript:ENSMMUT00000039678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REGFNCITFDMRGIGRSTGSSTFTGSDEVKDVVAMANYVRENLVPKGDTAQIILLGSSAG
AAIAGSAASLVDNCVALICIGYTFGYMARMLFGSRISKLEKFTGPKLFIMGTEDCWTGVS
QLVSYVHKLGPSAEYRLIDGAGHFDLENSTERTGQIVGFASDFITKASS
Download sequence
Identical sequences 9544.ENSMMUP00000032742 ENSMMUP00000032742 ENSMMUP00000032742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]