SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032838 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000032838
Domain Number - Region: 4-72
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000281
Family delta-Endotoxin, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032838   Gene: ENSMMUG00000000590   Transcript: ENSMMUT00000039773
Sequence length 530
Comment pep:known chromosome:MMUL_1:20:42338:88269:-1 gene:ENSMMUG00000000590 transcript:ENSMMUT00000039773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPRSRYAVNNTGDHADDQDGDARFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLL
QHALGQVSKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRC
QYLTREAKLILALQDEVSAMADGDVNGARSPFHHILPKCKLARDLKEAYDSLCTSGVVRL
HINSWLEVSFCLPHKIHYAASSLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPIDCS
PALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPN
ASVCLYSPLAEQFSHQFPSHDLPSVLAKFSLPVSLSEFRNPLAPAVQETQLIQMVVWMLQ
RRLLIQLHTYVCLMASPSEEEPRPREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLT
SPSMDNSSAELLPSGDSPLNQRMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHY
FRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPVIAVFQALLP
Download sequence
Identical sequences ENSMMUP00000032838 ENSMMUP00000000796 9544.ENSMMUP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]