SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033074 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033074
Domain Number 1 Region: 67-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-25
Family Canonical RBD 0.0000121
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.52e-17
Family Canonical RBD 0.0000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033074   Gene: ENSMMUG00000005993   Transcript: ENSMMUT00000008383
Sequence length 196
Comment pep:known chromosome:MMUL_1:4:140555977:140556735:1 gene:ENSMMUG00000005993 transcript:ENSMMUT00000008383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGMLTDCVVMRDPNTKRSRGFGFVTYATVVEVDAAMNARPHKVNGRVVEPKRSVSREDSQ
RPGARLTVKNIFVGGIKEDTEEHYLRDYFDQYGKIEVIEIMTDRGSGKKRGFAFVTFDNH
DSVDKTVIQKYHTVNGHNCEVRKALSKQEMASASSSQRSRSGSGNCYNDFGNYNNQSSNF
GAMKGGNFGGRSSGPY
Download sequence
Identical sequences ENSMMUP00000033074 9544.ENSMMUP00000033074 ENSMMUP00000033074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]