SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033171 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033171
Domain Number 1 Region: 67-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000154
Family LIM domain 0.014
Further Details:      
 
Domain Number 2 Region: 14-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000908
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033171   Gene: ENSMMUG00000029453   Transcript: ENSMMUT00000040099
Sequence length 193
Comment pep:known scaffold:MMUL_1:1099213972833:1715:2293:1 gene:ENSMMUG00000029453 transcript:ENSMMUT00000040099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERGTCWPMRVRRDGAWGRHESRSP
SSLLPSSDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAVRAPSLGLSPKSTS
PLFIAWGMQEKLGRGLYCCPQPHVTGPLLSLDMSDQPGRKDLLLQEGQAPLQEPCLLPRV
SPSCPQLPRRPQS
Download sequence
Identical sequences ENSMMUP00000033171 9544.ENSMMUP00000033171 ENSMMUP00000033171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]