SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033294 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033294
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily SNARE-like 2.47e-36
Family Synatpobrevin N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 133-195
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000115
Family SNARE fusion complex 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033294   Gene: ENSMMUG00000019347   Transcript: ENSMMUT00000040224
Sequence length 197
Comment pep:known chromosome:MMUL_1:4:104003086:104004094:1 gene:ENSMMUG00000019347 transcript:ENSMMUT00000040224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYSLSVLYKGEAKVVLLKVGYDDVASFSFSQRSSVQEFMTFTSQLIMERSSKGTRASV
AEQDYLWHVCVQNDSLAGVIITDNECPSLVAFTLLEKVLDEFSKQVNRKDWPVGSPATIH
SASLDGHLSRYQNPRDADPMTKVQAEPDETQIILHNTMDSLLERGEKLGGLVSKSEVLGT
GAFYKTARKQNSCCAMA
Download sequence
Identical sequences ENSMMUP00000033294 9544.ENSMMUP00000025419 ENSMMUP00000025419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]