SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033331 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033331
Domain Number 1 Region: 289-592
Classification Level Classification E-value
Superfamily Kelch motif 1.24e-61
Family Kelch motif 0.0000643
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily POZ domain 9.42e-33
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033331   Gene: ENSMMUG00000005093   Transcript: ENSMMUT00000040264
Sequence length 622
Comment pep:known chromosome:MMUL_1:4:93002706:93051375:1 gene:ENSMMUG00000005093 transcript:ENSMMUT00000040264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSERCLSIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIAEEQKFHAHKAVL
AACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGS
HLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPE
DVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQHMDELLQYIRFGLMDVDT
LHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKRE
VCKVKELRYFNPVDQENALIAAIANWSELAPMPVGRSHHCVAVMGDFLFVAGGEVEHASG
RTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYC
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPM
LQRRVYHSMAAVERKLYVLGGNDLDYNNDRILVRHIDSYNIDTDQWTRCSFNLLTGNCQN
ESGVAVHNGRIYLVGGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLP
APYFTCPNLQTLQVPHHRIGTV
Download sequence
Identical sequences 9544.ENSMMUP00000006749 ENSMMUP00000033331 ENSMMUP00000006749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]