SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033373 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033373
Domain Number 1 Region: 110-241
Classification Level Classification E-value
Superfamily GAT-like domain 2.83e-47
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.00000102
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.09e-34
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033373   Gene: ENSMMUG00000016703   Transcript: ENSMMUT00000040307
Sequence length 808
Comment pep:known chromosome:MMUL_1:4:79577129:79742594:-1 gene:ENSMMUG00000016703 transcript:ENSMMUT00000040307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLIQATNETNVNIPQMADTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTL
FNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMAPEK
LLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFF
EMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLN
TLEGKKPGNKSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKP
SSDLLDLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFA
PEPTPPTTTAEIATASASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPT
PVAAALDACSGNDPFAPSEGSAEAAPELDLFAMKPPETSVPVVTPTASTAPPVPATAPSP
APAVAAAAAATTAATAAATTTTTTSAATATTAPPALDIFGDAFSSPPQGASPVPESSLTA
DLLSDAFGSSASEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEA
AFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDS
SLASLVGNLGISGTTSKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVP
PTSSVPPVAGAPSVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLS
PSPTPATQSPKKPPAKDPLADLNIKDFL
Download sequence
Identical sequences ENSMMUP00000033373 ENSMMUP00000021958 9544.ENSMMUP00000021958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]