SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033476 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033476
Domain Number 1 Region: 2-26,57-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.03e-27
Family GidA-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033476
Domain Number - Region: 104-124,318-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0259
Family FAD/NAD-linked reductases, N-terminal and central domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033476   Gene: ENSMMUG00000019270   Transcript: ENSMMUT00000040415
Sequence length 643
Comment pep:known chromosome:MMUL_1:4:69717704:69718400:1 gene:ENSMMUG00000019270 transcript:ENSMMUT00000040415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGPAVWGLRAQID
RKLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPEHTGKCRVSGVVLVDGSTVYAESVI
LTTGTFLRGMIVIGLEMHPAGRLGDQPSIGLAQTLEKLGFVVGRLKTGTPPRIAKDSINF
SILNKQTPDNPSVPFSFTNETVWIKPEDQLPCYLTYTNPRVDEIVLNNLHLNSHVKETTR
GPRYCPSIESKVLRFPNRLHQVWLEPEGMDSDLIYPQGLSMTLPTELQEKMITCIRGLEK
AKVIQPDGVLLLLPRMECNGTISPHHNLSLPAGYGVQYDYLDPRQITPSLETHLVQRLFF
AGQINGTTGYEEAAAQVRILAHCNLRLLHSRHSPASASRVSGTIGACHYARLIFLARSWL
TATSASQVRAILLPQPPKWSLTLSGLQDSDSISKRKKKRNNLLVFILRFGIISKNLFLDL
PYMTWILMLMKLSYICRALDVLKYEEVDMDSLAKAVPEPLKKYTKCRELAERLKIEATYE
SVLFHQLQEIKGVQQDEALQLPKDIDYLTIRDVSLSHEVREKLHFSRPQTIGAASRIPGV
TPAAIINLLRFVKTTQQRQAAMNESPKTDQCLRNADRLQERQL
Download sequence
Identical sequences 9544.ENSMMUP00000025319 ENSMMUP00000025319 ENSMMUP00000033476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]