SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033632 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033632
Domain Number 1 Region: 70-317
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.64e-42
Family beta 1,4 galactosyltransferase (b4GalT1) 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033632   Gene: ENSMMUG00000029662   Transcript: ENSMMUT00000040582
Sequence length 327
Comment pep:known chromosome:MMUL_1:6:174130328:174140786:1 gene:ENSMMUG00000029662 transcript:ENSMMUT00000040582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSRRKAAQLPWEDGRSRLLSGSLPRKCSVFHLFVACLLLGCFSLLWLQLSCSGDVGRA
ARGQGQETSGPPRACPPEPPPEQWEEDASWGPHRLAVLVPFRERFEELLVFVPHMHRFLS
RKKIQHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYQLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFHHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVDSRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS
Download sequence
Identical sequences A0A096ND10 A0A2K5NBZ4 A0A2K5U1Y7 A0A2K6BHI9 F7G7M8
ENSPANP00000010733 ENSMMUP00000033632 ENSMMUP00000033632 NP_001247605.1.72884 XP_005558725.1.63531 XP_011743523.1.29376 XP_011906615.1.92194 9544.ENSMMUP00000033632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]