SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033695 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033695
Domain Number 1 Region: 316-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-62
Family SPRY domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 32-104
Classification Level Classification E-value
Superfamily RING/U-box 7.29e-16
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 3 Region: 110-139
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000733
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033695   Gene: ENSMMUG00000020899   Transcript: ENSMMUT00000040653
Sequence length 496
Comment pep:known chromosome:MMUL_1:7:23152498:23180897:1 gene:ENSMMUG00000020899 transcript:ENSMMUT00000040653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKVSSNSSNIDPGNYVEMNDSIAHLPSKVVIQDITMELHCPLCNDWFHDPLMLSCGHNFC
QACIQDFWRLQAKETFCPDCKMLCQYSNCTFNLVLDKLVEKIKKLPLLKGHPQCPEHGEN
LKLFSKPDGKLICFQCKDARLSVGQSKEFLQISDAVHFFTEELAIQQGQLETTLKELQSL
RNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLS
QLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLDSLEQGMRVLATRELISRKLNPGQ
YKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKNQTSVWHGDIKKVMPDDPERF
DSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRNQ
TDLKALDLPSCSLTLTNNLDKVGIYLDYEGGQVSFYNAKTMTHIYTFSNTFIEKLYPYFC
PCLNDGGENKEPLHIL
Download sequence
Identical sequences 9544.ENSMMUP00000027495 ENSMMUP00000027495 ENSMMUP00000033695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]