SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033746 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033746
Domain Number 1 Region: 580-708
Classification Level Classification E-value
Superfamily L domain-like 2.13e-33
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 343-543
Classification Level Classification E-value
Superfamily L domain-like 4.91e-24
Family Ngr ectodomain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 176-304
Classification Level Classification E-value
Superfamily L domain-like 1.76e-18
Family Ngr ectodomain-like 0.0022
Further Details:      
 
Domain Number 4 Region: 964-1044
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000752
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 806-932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000565
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 3-62
Classification Level Classification E-value
Superfamily L domain-like 0.000000000184
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 7 Region: 777-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 735-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033746   Gene: ENSMMUG00000017087   Transcript: ENSMMUT00000040711
Sequence length 1051
Comment pep:known chromosome:MMUL_1:6:165071770:165214493:-1 gene:ENSMMUG00000017087 transcript:ENSMMUT00000040711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAP
VHLRGFNVADVQKKEYVCPGKHSVTCPWPYYPLLQTLIVSSTPHSEPPSCNANSISCPSP
CTCSNNIVDCRGKGLTEIPANLPEGIVEISRTMMTIVRNHILGAGATYTKDSSINMDKKI
ISSVAPERMHRIRKVAGLGIHLNKAVVALKGSEFGVSGVRLSLLNANKINCLRVNTFQDL
QNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGA
RCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQK
LARIPSHLPEYVTDLRLNDNEISVLEATGIFKKLPNLRKINLSNNKIKEVCVSNDTFAGL
SSVRLLSLYDNRITTITPGAFTTLVSLSTINSFYSCSSYFHVALLSLVAGSLSPLHCRII
RWPLKGRLPLNLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQD
FTCDAINPHLKICPPQPSTASFCNLSACSHVLSLRTSFRYLEGNHLTAVPRELSALRHLT
LIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPIHAFNGLRSLRVLTLHGNDISSV
PEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTT
PTHRFQCKGPVDINIAAKCNACLSSPCKNNGTCTQDAVELYRCACPYSYKGKDCTVPINT
CIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNY
VCVCPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFRCECVPGYSGKLCETDNDDC
VAHKCRHGAQCMDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQ
QEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYK
GDNDPLALELYQGHVRLVYDSLSSPPTTVYR
Download sequence
Identical sequences ENSMMUP00000033746 9544.ENSMMUP00000033746 ENSMMUP00000033746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]