SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033751 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033751
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 1.33e-27
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 309-398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000659
Family Galactose-binding domain 0.047
Further Details:      
 
Domain Number 3 Region: 441-546
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000106
Family Galactose-binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033751   Gene: ENSMMUG00000001634   Transcript: ENSMMUT00000040716
Sequence length 612
Comment pep:known chromosome:MMUL_1:4:37978419:38415479:-1 gene:ENSMMUG00000001634 transcript:ENSMMUT00000040716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHVRILLWDRDSRSYSYFIEVSMDELDW
VRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGL
IVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYM
IGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVSFERQPASFIRIVG
THNTANEVFHCVHFECPEQQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSP
GSNSRSPNRQHQ
Download sequence
Identical sequences A0A2K5LI10 A0A2K5TJU1 A0A2K5ZXV8 A0A2K6AWX8 F6VQG7
XP_005553173.1.63531 XP_007970925.1.81039 XP_007970926.1.81039 XP_007970927.1.81039 XP_007970928.1.81039 XP_011727641.1.29376 XP_011727642.1.29376 XP_011727643.1.29376 XP_011727644.1.29376 XP_011842017.1.47321 XP_011929641.1.92194 XP_014991766.1.72884 XP_014991767.1.72884 XP_015304945.1.63531 9544.ENSMMUP00000033751 ENSMMUP00000033751 ENSMMUP00000033751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]