SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033888 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033888
Domain Number 1 Region: 38-156,198-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.29e-20
Family FAD-linked reductases, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033888   Gene: ENSMMUG00000021663   Transcript: ENSMMUT00000040860
Sequence length 502
Comment pep:known chromosome:MMUL_1:6:145834572:145842104:1 gene:ENSMMUG00000021663 transcript:ENSMMUT00000040860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFKHLGTTSAGGYSVNCSLSLSCSVSLLPYLPGLLTAVVGAGIGGSAVAHFLQQHFGPR
VQIDVYEKGTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAI
FGGEHFVLEETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVE
ELLYSLGESTFVNMTQHSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSL
AGAQGSLWSVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVAYENEVGNSS
DFYDIVVIATPLHLDNSSSNLTFAGFHPPIDDLQGSFQPTVVSLVHGYLNSSYFGFPDPK
LFPFANILTTDFPSFFCTLDNMCPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFR
SYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYN
RWYQDLDKIDQKDLMHKVKTEL
Download sequence
Identical sequences F6TMZ8
ENSMMUP00000033888 XP_011714350.1.29376 XP_015307604.1.63531 9544.ENSMMUP00000033888 ENSMMUP00000033888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]