SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033903 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033903
Domain Number 1 Region: 29-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033903   Gene: ENSMMUG00000029782   Transcript: ENSMMUT00000040875
Sequence length 86
Comment pep:known chromosome:MMUL_1:6:144872999:144877270:1 gene:ENSMMUG00000029782 transcript:ENSMMUT00000040875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRATAIVLLLALTLATMFSVECAQQTKQMVDCSDYKKLPPGQERFCHHMYELICGSDGKT
YKNDCFFCSQVKKTDGKLKFVHYGKC
Download sequence
Identical sequences A0A096N736 A0A0D9RHL1 A0A2K5MJD0 A0A2K6CCD6 G7MVF6 G7P8M4
ENSMMUP00000033903 ENSMMUP00000033903 NP_001180370.1.72884 XP_005558252.1.63531 XP_011714378.1.29376 XP_011924084.1.92194 9544.ENSMMUP00000033903 ENSPANP00000008319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]