SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033913 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033913
Domain Number 1 Region: 122-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-20
Family SPRY domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033913   Gene: ENSMMUG00000029784   Transcript: ENSMMUT00000040885
Sequence length 329
Comment pep:known chromosome:MMUL_1:7:11865360:11876796:1 gene:ENSMMUG00000029784 transcript:ENSMMUT00000040885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNP
RLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVE
RSYAVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGY
FGRTWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQ
IGRMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVM
LHNVYGPGRSGGPRPEAPPKSPVNRQLLT
Download sequence
Identical sequences F6VSP1 G7PAN4
ENSMMUP00000033913 9544.ENSMMUP00000033913 ENSMMUP00000033913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]