SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033921 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033921
Domain Number 1 Region: 781-844
Classification Level Classification E-value
Superfamily FF domain 1.57e-16
Family FF domain 0.0000214
Further Details:      
 
Domain Number 2 Region: 651-716
Classification Level Classification E-value
Superfamily FF domain 9.42e-16
Family FF domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 714-776
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000445
Family FF domain 0.0033
Further Details:      
 
Domain Number 4 Region: 886-957
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000115
Family FF domain 0.0000104
Further Details:      
 
Domain Number 5 Region: 952-1009
Classification Level Classification E-value
Superfamily FF domain 0.0000000000419
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 432-464
Classification Level Classification E-value
Superfamily WW domain 0.00000000046
Family WW domain 0.00032
Further Details:      
 
Domain Number 7 Region: 136-168
Classification Level Classification E-value
Superfamily WW domain 0.000000000668
Family WW domain 0.0011
Further Details:      
 
Domain Number 8 Region: 521-559
Classification Level Classification E-value
Superfamily WW domain 0.0000000668
Family WW domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033921
Domain Number - Region: 1013-1078
Classification Level Classification E-value
Superfamily FF domain 0.0089
Family FF domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033921   Gene: ENSMMUG00000023288   Transcript: ENSMMUT00000040892
Sequence length 1096
Comment pep:known chromosome:MMUL_1:6:142904059:142967750:1 gene:ENSMMUG00000023288 transcript:ENSMMUT00000040892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGGDGGDGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
VQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPTTQ
DQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVM
VPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAAS
PATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSE
EPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDE
RVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQF
SMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEAR
MKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKK
NKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARK
KEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQ
YIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQN
FKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFR
QLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTL
LKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRG
PPPPPTASEPTRRSTK
Download sequence
Identical sequences A0A2I3LD62 A0A2K5NBW4 A0A2K5VRS7 A0A2K6AU24 F7FFI0
ENSMMUP00000033921 9544.ENSMMUP00000030652 ENSMMUP00000030652 XP_001101428.1.72884 XP_005558200.1.63531 XP_011714441.1.29376 XP_011946067.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]