SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033933 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033933
Domain Number 1 Region: 57-189
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 9.29e-34
Family Alpha-macroglobulin receptor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000025
Family Ovomucoid domain III-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033933   Gene: ENSMMUG00000029788   Transcript: ENSMMUT00000040903
Sequence length 320
Comment pep:known scaffold:MMUL_1:1099214740099:9:6654:-1 gene:ENSMMUG00000029788 transcript:ENSMMUT00000040903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQIDVTYNVPDPVAKPAFQLLVSLQEPEAQGRPPPMPSSSAEGSRGDRPPADDDDPAADQ
HHQEYKVMLEVCTRWLHAGSSNMAVLEVPLLSGFRADIESLEQLLLDKHMGMKRYEVAGR
RVLFYFDEIPSRCLTCVRFRALRECVVGRTSALPVSVYDYYEPAFEATRFYNVSAHSPLA
QELCAGPACNEVERAPARGPGWSPGESGPGVAPEEGAAITRCGCDHGCGAQGDPVCGSDG
VVYASACRLREAACRRAAPLEPAPPSCCALEQPLPASVSSTYGDDLASVAPGHLQQDLKL
SGAGLEVVDSDPEPEGEVED
Download sequence
Identical sequences 9544.ENSMMUP00000033933 ENSMMUP00000033933 ENSMMUP00000033933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]