SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034020 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000034020
Domain Number - Region: 117-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00241
Family BAR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034020   Gene: ENSMMUG00000012553   Transcript: ENSMMUT00000040990
Sequence length 717
Comment pep:known chromosome:MMUL_1:7:2536029:2540429:1 gene:ENSMMUG00000012553 transcript:ENSMMUT00000040990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESKDLAGRLQHSLQHRGELQRALSAVTATQKKVDRYDTISVERYFLSFGLCKDSGSNNTV
NSISFPVPSKFRVLLKTRAWARNLALALLRGTVWNGPGSPDGNFSLFTIQFSSRSQALTE
WQLEQSIQEKARLKAQLTQLKESLKQVQLERDEYAQHIKERVWWQQRMRKMSQEVCTLKK
EKKDDMRRVEKLERSLSKLKNRMAKPLPPECPAVPPEEELQHLRKELERVSAELQAHVEN
HQHVSLLNQAQKERLGRQEERLQQLPEPQSGVEELVRCPPGQPILLPSPSCEMLLLKAPV
SQSPALVAVGQRNNENKSALQLEQQIEELQEKLDEVKETVELKSQEAQSLQQQPDHYLGH
LQQSVATYQQQVAAYQQLTSEKEALHRQLLQQTQLMNQLQQQEAWGKAVAEMARQKLQET
REHLEAARQQNQQLTAQLRLTALPGEGTGGHSEEEDRAPGGSEEEEGPRPMPSVPEDQES
WEAMVPFFKSAGASAQEEQARLSEQVKEQRVCCQHLAHPVVLSQKESEAAVPAPGTGGES
VSGETPWTLQEVMEKLQSGRMDHLEEKADLREQVEILEREMPSVSGRPGHRRGSYRALGG
SQGPVPKMRQWEEDIIRLAQDREEMKVKLLALQEMLLQLGDYNKGHHKFLATAQNPADEP
GPGAPAPQELGAADKHGDLCDMSLTDSVEPAHGEATEGSPHDNHSAQPTCRSTRSTQ
Download sequence
Identical sequences 9544.ENSMMUP00000034021 ENSMMUP00000034021 ENSMMUP00000034020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]