SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034135 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034135
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily EF-hand 1.21e-31
Family Calmodulin-like 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034135   Gene: ENSMMUG00000002881   Transcript: ENSMMUT00000004080
Sequence length 149
Comment pep:known chromosome:MMUL_1:16:66850418:66850873:1 gene:ENSMMUG00000002881 transcript:ENSMMUT00000004080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDFTEDQTAEFKEAFQLFDRIGDGKILCNQYGDVMRALGQNPTNTEVLNVLGNPKSNEM
NVKVLEFEHLLPILQTVAKNKDQGTYEDYVEGLQVFDKEGNGTVMGVEFWLVLVTLGEKI
TEEEVEVLVAGNEGSNGCINYEAFVRHIL
Download sequence
Identical sequences ENSMMUP00000034135 ENSMMUP00000034135 9544.ENSMMUP00000034135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]