SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034232 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034232
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-36
Family Second domain of FERM 0.0000433
Further Details:      
 
Domain Number 2 Region: 204-351
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-35
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034232   Gene: ENSMMUG00000012192   Transcript: ENSMMUT00000041196
Sequence length 686
Comment pep:known chromosome:MMUL_1:6:108415624:108482200:-1 gene:ENSMMUG00000012192 transcript:ENSMMUT00000041196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSIVLDHVFHHVNLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTTGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPCEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQ
PTGSNSISRITTHMENGENEGTTKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPMRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRIRQENDMIDSAPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPVRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGDATVHQRRNGSKDSLMEEKPQI
SPNNLAGKHTAKTIKTIQASRLKTET
Download sequence
Identical sequences ENSMMUP00000015985 ENSMMUP00000034232 9544.ENSMMUP00000015985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]