SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034273 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034273
Domain Number 1 Region: 30-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000572
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034273   Gene: ENSMMUG00000029892   Transcript: ENSMMUT00000041239
Sequence length 118
Comment pep:known chromosome:MMUL_1:4:27879739:27880095:1 gene:ENSMMUG00000029892 transcript:ENSMMUT00000041239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQNLKTLDLVSVLSDIRELLWISSVWKAFCVSSVLLNISKFILDKSLIYIRGCSKASKC
CDSLIKHQRICTAEKPYWSEEDSKRFIVVQLWSPTRESTLESSTVMNVVYEGRPLFGS
Download sequence
Identical sequences A0A2K5XFT5 F7CBL3 Q9BGP0
ENSMMUP00000034273 9544.ENSMMUP00000034273 ENSMMUP00000034273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]