SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034300 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034300
Domain Number 1 Region: 416-609
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000391
Further Details:      
 
Domain Number 2 Region: 234-318
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000218
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 26-62
Classification Level Classification E-value
Superfamily WW domain 0.00000000954
Family WW domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034300
Domain Number - Region: 138-166
Classification Level Classification E-value
Superfamily WW domain 0.000465
Family WW domain 0.004
Further Details:      
 
Domain Number - Region: 110-138
Classification Level Classification E-value
Superfamily WW domain 0.0233
Family WW domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034300   Gene: ENSMMUG00000021932   Transcript: ENSMMUT00000041266
Sequence length 611
Comment pep:known chromosome:MMUL_1:16:55494364:55505003:-1 gene:ENSMMUG00000021932 transcript:ENSMMUT00000041266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVDDPPEPVYANIERQPRATSPSAAAVPLPSPVWETHTDAGTGRPYYYNPDTGVTTWES
PFEAAASPATSPASVDSHPPTPETDYPESLTSYPEEDYSPVGSFGEPGPTSPLTTPPGWS
CHISQDKQTLYTNHFTQEQWVRLEDPYGKPYFYNPEDSSVRWELPQVTTWGKGGAGERGR
DHIRLCLSPQVPVPAPRSIHKSSQDDDTPAQASPPEEKSSPQVPAELDETKTLDKAGVLH
RTKTAEKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLFSTPEYTVELRGATLSWA
PKDKSSRKNVLEVSSQAGALVKLRSDISVLFNLFFMVKWANRRCAAQAGVWEVVGTPGCR
RWDNVSESSVLEKLRKTEEEGSRESDLSKVRYKLRKFLQRRPTLQSLREKGYIKDQVFGC
ALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLD
DGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQAQRSRCVRDLVRSLPAP
NHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMPMTMVFQNQVVEL
ILQQCADIFPP
Download sequence
Identical sequences ENSMMUP00000034300 ENSMMUP00000034303 9544.ENSMMUP00000034303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]