SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034347 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034347
Domain Number 1 Region: 115-316
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.06e-17
Family YhfI-like 0.066
Further Details:      
 
Domain Number 2 Region: 19-122
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000000498
Family Ring hydroxylating alpha subunit ISP domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034347   Gene: ENSMMUG00000005964   Transcript: ENSMMUT00000041315
Sequence length 589
Comment pep:known chromosome:MMUL_1:4:25094214:25152857:-1 gene:ENSMMUG00000005964 transcript:ENSMMUT00000041315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHSTEQTTEILLCLSPVEVANLKEGINFFRNKSTGKDYILYKSKSRLRACKNVCKHQGGL
FIKDIEDLAGRSVRCTKHNWKLDVSTMKYINPPESFCQDELVVEMDENNGLLLLELNPPN
PWDSEPRSPEELDFGEVQITYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPSD
WLERLCQADLIYISHLHSDHLSYPTLKKLAGRRPDIPIYVGNTERPVFWNLNQSGVQLTN
INVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPTKV
ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKAQLVKNLQPRIYCPFAG
YFVESHPSDKYIKETNTKNDPNELNNLIKKNSDVITWTPRPGATLDLGRMLKDPTDSKGI
IEPPETKIYKDSWDFEPYLEILNAAVGDEIFLHSSWIKEYFTWAGFKDYNLVVRMIETDE
DFNPFPGGYDYLVDFLDLSFPKERPQREHPYEEIRSRVDVIRHVVKNGLLWDELYIGFQT
RLQRDPDIYHHLFWNHFQIKLPLTPPNWRSFLTCCEQNGPGISQECKTT
Download sequence
Identical sequences 9544.ENSMMUP00000007844 ENSMMUP00000034347 ENSMMUP00000007844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]