SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034581 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034581
Domain Number 1 Region: 271-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-53
Family SPRY domain 0.0000331
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000505
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 75-130
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000565
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034581   Gene: ENSMMUG00000030038   Transcript: ENSMMUT00000041555
Sequence length 445
Comment pep:known chromosome:MMUL_1:5:157123175:157124541:1 gene:ENSMMUG00000030038 transcript:ENSMMUT00000041555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EASCPICLDYLKDPVTISCGHNFCLSYIIMSWKIFPCPFCHFCCPERKFVSNPQLGSLTE
LAKQLQIRSKRKRQEEKHVCKKHNQLLTFFCQKDLELLCPRCSFSTDHQHHCVWPIKKAA
SYHRKKLEEYNAPWKERVELIEKVITMQTRKSLELKKQVKHRAEEVKSEFEQLRLFLQNQ
QETVLRQLQDEEMDILAQLNESLTKFSDYTSSLKYLLKEIESIHVKSELELLANVKDIYH
RYKNLKFPEPFSFKLKEYGYHLPPQYSGLNKIIKRFQVDVILDPETAHRKLIVSEDRKTV
RYGNTTQNLPRNPRRFYLLPAVLGSKGYSCGRQYWEVEVKDKPEWILGVCNDSLPRRRKS
QPILVQDRLWNNYIVLGHKEIILLPKVTPSKIGIFLDYEMNDISFYNLNDRSLLYTFNDD
FTGALWPYFYTGTDSRPLKISTVTD
Download sequence
Identical sequences ENSMMUP00000034581 9544.ENSMMUP00000034581 ENSMMUP00000034581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]