SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034612 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034612
Domain Number 1 Region: 364-415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 209-262
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 274-325
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000229
Family ATI-like 0.067
Further Details:      
 
Domain Number 4 Region: 19-75
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000621
Family ATI-like 0.013
Further Details:      
 
Domain Number 5 Region: 417-466
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000036
Family BSTI 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034612   Gene: ENSMMUG00000011121   Transcript: ENSMMUT00000041586
Sequence length 484
Comment pep:known chromosome:MMUL_1:3:187122065:187126996:1 gene:ENSMMUG00000011121 transcript:ENSMMUT00000041586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFLHLDTQGCYPGPCPEDSCTPPFEFHACGSPCAGLCATHLSHQLCQDLPPCQPGCYCPK
GLLEQAGGCIPLEQCNCWHTSAAGARITLAPGDRLQLGCKECECRRGELHCTSQGCQGLL
PLSEWSEWSPCGPCLPPSALASASRTALEERWLQDPTSLSPTSAPLLASEQHRHRLCLDP
VTGRPWTGAPHLCTAPLRQQRLCPDPGACPDSCQWSLWGPWSPCQVPCSGGFRLRWRGTE
APTGGGCQGPWAQTESCNRGPCPGESCEARNTVFTLDCASQCPRSCADLWDRVQCLQGPC
RPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPAQVVQLDCQNCTCVNGSLVCPH
QGCPVLGPWSAWSSCSAPCGGGTMERHRSCEGGPGMAPCQAQDTEQRQECNLQPCPECPP
GQVLSACATSCPRLCWHLQPGAICVQEPCQPGCGCPGGQSAPLEKCGSRWPRGSWGSASR
RARI
Download sequence
Identical sequences G8F5G2
9544.ENSMMUP00000014560 ENSMMUP00000034612 ENSMMUP00000014560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]