SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034687 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034687
Domain Number 1 Region: 1946-2345
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.3e-119
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 1614-1941
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.22e-83
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000012
Further Details:      
 
Domain Number 3 Region: 278-529
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.02e-69
Family BC ATP-binding domain-like 0.0000000511
Further Details:      
 
Domain Number 4 Region: 129-277
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.32e-52
Family BC N-terminal domain-like 0.00000256
Further Details:      
 
Domain Number 5 Region: 539-653
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.03e-29
Family BC C-terminal domain-like 0.0000042
Further Details:      
 
Domain Number 6 Region: 782-854
Classification Level Classification E-value
Superfamily Single hybrid motif 0.000000000654
Family Biotinyl/lipoyl-carrier proteins and domains 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034687
Domain Number - Region: 905-1190
Classification Level Classification E-value
Superfamily ARM repeat 0.00691
Family Clathrin adaptor core protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034687   Gene: ENSMMUG00000009349   Transcript: ENSMMUT00000041664
Sequence length 2383
Comment pep:known chromosome:MMUL_1:16:47080900:47362011:-1 gene:ENSMMUG00000009349 transcript:ENSMMUT00000041664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWSTLMSILRASSFWRWISTQTIRIIRALRAHFGGIMDEPSPLAKPLELNQHSRFIIGS
VSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHIRSSMSGLH
LVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYE
MFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQ
AVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS
GLRMDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRK
VNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQ
VEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRG
HVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW
GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQA
ERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVL
KVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTC
VFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVK
RPGAALDPGCVLARMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV
MNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMA
QYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHM
KAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTM
LIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESI
FLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL
NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMSCFSDSPPQSPTFPEAGHTSLYDEDKVPRD
EPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYE
VDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDWLFLRAS
ELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCR
AIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHC
TVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRECSQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGT
VEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLIPIYHQVA
VQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQ
IQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQ
IRSLVQANPEVAMDSIIHMTQHISPTQRAEVVRILSTMDSPST
Download sequence
Identical sequences A0A2K5MJK7 A0A2K5XXS3 A0A2K6E1M4 F7H9H5 G7PUJ1
NP_001253707.1.72884 XP_005583989.1.63531 XP_011731478.1.29376 XP_011845607.1.47321 XP_011910478.1.92194 9544.ENSMMUP00000034688 ENSMMUP00000034688 ENSMMUP00000034687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]