SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034812 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034812
Domain Number 1 Region: 439-570
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-35
Family Cadherin 0.00057
Further Details:      
 
Domain Number 2 Region: 2214-2416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.88e-30
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 3 Region: 960-1070
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-29
Family Cadherin 0.00038
Further Details:      
 
Domain Number 4 Region: 230-353
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-28
Family Cadherin 0.00048
Further Details:      
 
Domain Number 5 Region: 1690-1811
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-28
Family Cadherin 0.00082
Further Details:      
 
Domain Number 6 Region: 1380-1491
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 7 Region: 341-443
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 8 Region: 1479-1589
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-27
Family Cadherin 0.0007
Further Details:      
 
Domain Number 9 Region: 132-241
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-26
Family Cadherin 0.00083
Further Details:      
 
Domain Number 10 Region: 649-755
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-26
Family Cadherin 0.00038
Further Details:      
 
Domain Number 11 Region: 2483-2640
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-24
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 550-661
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 30-131
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-24
Family Cadherin 0.00055
Further Details:      
 
Domain Number 14 Region: 751-862
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 15 Region: 1163-1272
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 16 Region: 1274-1377
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.00075
Further Details:      
 
Domain Number 17 Region: 1064-1162
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.00099
Further Details:      
 
Domain Number 18 Region: 1589-1694
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 19 Region: 1800-1903
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 20 Region: 861-966
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0037
Further Details:      
 
Domain Number 21 Region: 2101-2114,2145-2237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000113
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 22 Region: 2667-2704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034812
Domain Number - Region: 1905-1995
Classification Level Classification E-value
Superfamily Cadherin-like 0.00113
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 2641-2664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0796
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034812   Gene: ENSMMUG00000011810   Transcript: ENSMMUT00000041802
Sequence length 3220
Comment pep:known chromosome:MMUL_1:5:117794742:117833894:1 gene:ENSMMUG00000011810 transcript:ENSMMUT00000041802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITTVVAVDDTAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLT
AMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSS
DMRINITVSDVNDHTPKFSRPMYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNED
DEDGIFFLNPITGVFNLTRVLDYEVQQYYILTVRAEDGGGQFTAIRVYFNILDVNDNPPI
FSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSELAYSIASGDSLGQFTVDKNGLLKVL
KALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENT
PIDTVVFKAQASDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLT
VVATDKGQPSLSSSTEVIVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDE
GTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQAADRGSTPRTDTS
TVSIVLLDINDFVPVFELSPYSVNVPENLRTLPRTILQVVARDDDQGSNSKLSYVLFGGN
EDNAFTLSASGELGVTQSLDRETKEQFVLMITAVDGGSPALTGTGTINVIVDDVNDNVPT
FASKAYFTTIPEDAPTGTDVLLVNASDADASTNAVVRIIGGNSQFTINPSTGQIITSALL
DRETKDNYTLVVVCSDAGYPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGS
FVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHVKDG
GSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTISGSSLRGEPMSYYI
ASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVN
DNAPIFKEDPFVSEILENLSPRKILTVSAVDKDSGPNGQLDYEIVNGNMENSFNINHATG
EIRSVRPLDREKVSYYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPE
NSPLGYTVTRVTTSDEDIGINAISRYSIMDTSLPFTINPSTGDIVISRPLNREDTDRYRI
RVSAHDSGWTVSTDVTIFVTDVNDNAPRFSRPSYYLDCPELTEIGSKVTQVFATDPDEGS
NGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGNPSL
ISETTVTINVVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIKVIAIDDKDFGLNSEVEYFI
SNDNHLGKFKLDNDTGWISVASSLISDLNQNFCITVTAKDKGNPPLSSQATVEITVTEEN
YHTPEFSQSHMSATIPESHSVGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSST
GILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTV
LENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVVDPNTGVITTQGFLDFETKQS
YHLTVKAFNVPDEERCSFATVNVQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFAS
DRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKILAKNFGSIRG
ADIDEVTVNVTVLDANDPPVFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYF
IGSGNENGAFSINPQTGQITITAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDI
NDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATNYFSLSTV
GVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNY
YGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSIPGGTCDLNSQPRSTDGTFDLTV
LSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGIPTVKDFLTNHYLHFLRIASSQLTG
LGTAVQLYSAYEENNRTFLLAAVKRNHNQYVNPSGVATFFESIKEILFRQSGVKVESVDH
DSCVHGPCQNGGSCLRRLAVSSVLKSRESLPVIIVANEPLQPFLCKCLPGYAGSWCEIDI
DECLPSPCHNGGTCHNLVGGFSCSCPDGFTGRACERDINECLQSPCKNGAVCQNFPGSFN
CVCKTGYTGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQ
TGDRAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSC
SENQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCIMEFA
VNGRPLEPSQALAAQGILDQYGNFISYCFKEKECKVCFTLTPDTALSLEGKGRLDYHMSQ
NEKREYLLRQSIRGAMLEPFGVNSLEVKFRTRSENGILIHIQESSNYTTVKIKNGKVHFT
SDAGIAGKVERNIPEVYVADGHWHTFLIGKNGTATVLSVDRIYNRDIIHPTQDFGGLDVL
TISLGGIPPNQAHRDAQTAGFDGCIASMWYGGESLPFSGKHSLASISKTDPSVKIGCRGP
NICASNPCWGDLLCINQWYAYRCVPPGDCASHPCQNGGSCEPGLDSGFTCSCPDSHTGRT
CEMVVACLGVLCPQGKVCKAGSPAGHVCVLSQGPEEISLPLWAVPAIVGSCATVLALLVL
SLILCNQCRGKKAKNPKEEKKPKEKKKKGSENVAFDDPDNIPPYGDDMTVRKQPEGNPKP
DIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQ
FRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYGQGLRTSSLSHSACPTPNPLSRH
SPAPFSKSSTFYRNSPARELHLPIRDGNTLEMHGDTCQPGIFNYATRLGRRSKSPQAMAS
HGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRR
PLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKPMVYTSRMPKLSQVNESDADDE
DNYGARLKPRRYHGRRAEGGPVGTQAAAPGAADNTLPIKLGQQAGTFNWDNLLNWGPGFG
HYVDVFKDLASLPEKAAANEEGKAGTTKPVPKDGEAEQYV
Download sequence
Identical sequences ENSMMUP00000034812 9544.ENSMMUP00000015496 ENSMMUP00000015496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]