SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034923 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034923
Domain Number 1 Region: 45-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-264
Family Motor proteins 0.000000000174
Further Details:      
 
Domain Number 2 Region: 1211-1307
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-27
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 3 Region: 1390-1509
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1793-1862,1905-1949
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-17
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 5 Region: 1327-1382
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000215
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1173-1211
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034923
Domain Number - Region: 818-928,1213-1238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000753
Family BAR domain 0.037
Further Details:      
 
Domain Number - Region: 1700-1786
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0214
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1953-2039
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034923   Gene: ENSMMUG00000012672   Transcript: ENSMMUT00000041914
Sequence length 2057
Comment pep:known chromosome:MMUL_1:6:16860121:16964393:-1 gene:ENSMMUG00000012672 transcript:ENSMMUT00000041914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLFCLQGTRVWLRENGQHFPSTVNSCAEGVVVFRTDYGQVFTYKQSTITHQKVTAMHPT
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEHATMEQ
YSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTI
SDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAE
LLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR
IKGKEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYS
GMLETVRIRKAGYAKVPCVSFRCRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLGK
TKVFLRESLEQKLEKRREEEVSHAAMVIRAYVLGFLARKQYRKVLYCVVIIQKNYRAFLL
RRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERER
QRREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQ
RMKEQQELSLTEASLQKLQQRRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSL
SVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTS
GIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLTPSVQDSGSLHNSSSGESTYCMPQNAGD
LPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSMGTYNSSGAYRFSSEGA
QSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLKD
ETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGTV
EVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMHD
EQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQR
SKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGT
LVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKAP
IDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKG
YTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPG
SVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKC
REFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNM
FALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDS
VEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLK
ARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVSSAR
ASIIDKWKKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVS
VYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIV
KKRYSTTRSASSQGSSR
Download sequence
Identical sequences ENSMMUP00000034923 ENSMMUP00000016643 9544.ENSMMUP00000016643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]