SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034993 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000034993
Domain Number - Region: 1723-1790
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 0.000667
Family Lipovitellin-phosvitin complex, superhelical domain 0.02
Further Details:      
 
Domain Number - Region: 1633-1762
Classification Level Classification E-value
Superfamily ARM repeat 0.0482
Family Leucine-rich repeat variant 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034993   Gene: ENSMMUG00000001063   Transcript: ENSMMUT00000041985
Sequence length 1796
Comment pep:known chromosome:MMUL_1:6:5342904:5416335:1 gene:ENSMMUG00000001063 transcript:ENSMMUT00000041985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDRKRDILHETKTQMEVREMDKSVQTEKTVHKLTRGLCIERLSASPAQEKEAAPRKSEL
CSSHLGKRPLNELMESEGKTPLSKMIGSPKSEFTKWTRINEITSEPDCVTVSGHFHGLSR
ELEKEKEDTQGFSLGESPESEDDDSGDAMDVAGLDFETSFSSSSTLVALSVGSNPQSSSR
LDCGNDPDITTKVFSTEPPHSEHKLQTKTLNTLHLQSEPPECSIGRNTLENSLRALSPEL
GASNFNDQKSSGIEYAKVVKDLTKIHSLPRSVFMKATKDGQCESQDPRIELTLNKPDFTS
LIGSQAALIKSGLGFVKSTSWHHSDLLRKGGEESLRAKSEHEQKTSQLQKAVPSLQNRGP
TPKPNLKENNNPVEFKTTASVLPNQVSVITKQTRTEKVQSAKLEHLRPHRNEPTLVTENN
GNKTGMSTIAECAGEGDDTTQNIREVAAVKSISPEVSASRRKLDFNCAGGSSPVENSDCS
TNSRVSFSSENVLVQNQDTVREAAVQGDRQKQRQPQATDLDSSGTDGSEGLPATEVTMSG
GFSVEKTSCGDTGRSGGEALAVVNDSTGTSQNANGLWKLKSTTPGGALLECFGTADTTVS
SAFCQKEGETQDTSQSSLPGTLHCYTGIREGGDDTEVEESEAFSCSEGSEQQDAPDDPQK
NSGDTDAGVAEVRPSLEVGYLTSALQDFNISTFSELDRLSTSEVVMFLESCQLGDYSSGD
SVSECSSKGTLNKEMNKELKPSEIAGEKYRKQPCEEETLGTCEEWIEPEEDDYLLKNTSQ
LTQCSLETLSEVLTKIRQELQTNAEDCNGKDTGSLLLLNINNNMTTENLREKSPFRETTG
SSSHASESAPQTAALDTEGSSPIGGRPQNENTETRPEASSDAGGQTDGGKEVLPEPVEPS
ALCSDSVTEPSTEQSSNCEAETTFQCQIATVTSEVINVLINKDQNLVIEKGDNWTIISGV
AVLPHVDQVTLCDFPGDIPISQAQGELEAGCIPVTSAEKSPEASHTGPALQEVPCGNNLS
CPQEDVSSTGQSTNFDKSRLRNRPVKPSIWISSQIYDQNFETQIVASDHTYYNSKLEPSG
KNKNRSKISNKDQSNKPVKTSASSRVETHQSEVAQSFSGEKANTKTQRSQTQTILANADT
STPTDCSPDTLSKIRQEVGPPLPPLLAPLIATPPRTSQPLSPLISSSSPSSPTSPVGQIS
PLCETPVPPVMSPWPEDPRRASPPDPSPSPSAVSASERVVSSPLQFCAATPKHALPVPGR
LPPCASGHAAVGGPQENSVKILDTMYPELSARARTLNILKGNIQLTRGPSADCKNLPGPA
SAMIGFKTITSAATAFVKTGSSSGGDCNQDKSRDLGTQQDSGGKRTLSASTLRSAKRLRL
DTGSPEPETRGVTAEGIHKNLPGNLPPAEIATTDAERSCSSPAISAVSQLPLNPKETVES
HDKAIANALKKIAEFSFDLLPVIRSHVYVGNISKKPVMRDQEKEVVYEFSTTKKHLAECL
LHSILSELKIQKISMDHNYIHALCRVYVGICRQLGDLERARLFCYSLLKEDFPESEKLTL
FIANMWHDIFLSQSVINKAMQLVARQRAKGEVLNCLRAFLNWEKNAPVDVGFMVSKLLLT
IQLCPKTEFQSSEKFGEDLSDNTWEYIFAIDLLCCHQKWIWTHDNIISKELWPVMDKWIK
YRKGHANIAYTPDIIIASILRLIGRLGQLGLKEGFPSAVKNISSVIGMFIQHAHDEDIPW
GIQLAAVYALCDLSPSNPAEISKILEAWRREASKSVPSAIVSCLEEVSALSTEELG
Download sequence
Identical sequences 9544.ENSMMUP00000001424 ENSMMUP00000001424 ENSMMUP00000034993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]