SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035030 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035030
Domain Number 1 Region: 123-215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 44-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000138
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035030   Gene: ENSMMUG00000013279   Transcript: ENSMMUT00000042027
Sequence length 262
Comment pep:known chromosome:MMUL_1:16:25557418:25575486:-1 gene:ENSMMUG00000013279 transcript:ENSMMUT00000042027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWNSSVVMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQVSLICAVQNHT
REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDPSVSISVALNVI
FPPLLSGNNFQTVEEGSNVKLVCSVKANPQAQMMWYKNSSLLDLEKSHHQIQQTSESFQL
SITKVEKSDNGTYSCTAKSSLQTESLDFHLIVKDKTVSVPVEPIIAACVVIFLTLCFGLV
ARRKKIMELCMKDKDPHRETAL
Download sequence
Identical sequences A0A2K6DH53 F6UVI8
ENSMMUP00000035030 NP_001181460.1.72884 XP_011731370.1.29376 XP_011731379.1.29376 ENSMMUP00000035030 9544.ENSMMUP00000035030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]